Protein Info for IAI46_21085 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 368 to 392 (25 residues), see Phobius details amino acids 398 to 417 (20 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 382 (350 residues), 158.3 bits, see alignment E=1.3e-50 amino acids 275 to 414 (140 residues), 44.5 bits, see alignment E=5.2e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to spe:Spro_3962)

Predicted SEED Role

"Probable glucarate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>IAI46_21085 MFS transporter (Serratia liquefaciens MT49)
MTTQEIDARAERVGDAVAENPQQRVRWSVPIALFACVLLAFFDKISIAALFSDNEFQQAL
GISFDPARLGLLMSAFLFSYGISSMLLSGIGDRLNPVKVLIGMMVVWGVLMVLMGMTRSY
HSMMTLRILLGIAEGPLLPMAYAIIRQAFPQRLQARATMLWLLGTPLGAALGFPVTLYIL
NTFDWQTTFFFMAFLTLPVMLLVLFGMRHLNVSRPAAASVSKPAIAERKQHRHELLRNPH
FWMICLFNIAFLTYLWGMNGWLPSYLIKGKGIHLEHAGYLSSLPFIAMLLGEVVGAWLSD
KLDRRALACFVSLCGAGLGLAVVLQLQGTYSVIAAMAFSTFMWGAGAPNIFALLAKATSS
KVSATAGGIFNGLGNFAGALAPVLMGALIAATGNMDNGLLFLVVMALIGCIILLPLLKKY