Protein Info for IAI46_21065 in Serratia liquefaciens MT49

Annotation: aspartate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 8 to 116 (109 residues), 51.3 bits, E=1.9e-17
• PF01958: Asp_DH_C
  • amino acids 164 to 251 (88 residues), 110.7 bits, E=3.4e-36

Best Hits

Swiss-Prot: 96% identical to ASPD_SERP5: Probable L-aspartate dehydrogenase (nadX) from Serratia proteamaculans (strain 568)

KEGG orthology group: K06989, aspartate dehydrogenase [EC: 1.4.1.21] (inferred from 96% identity to spe:Spro_3958)

Predicted SEED Role

"Aspartate dehydrogenase homolog"

MetaCyc Pathways

• NAD de novo biosynthesis III (6/6 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.21

Protein Sequence (264 amino acids)

>IAI46_21065 aspartate dehydrogenase (Serratia liquefaciens MT49)
MKKIMMIGYGAMATEVLSRLPDGVSVGWIVARAAHHAAIANAFGGQVQALTHPDHCAEKP
DLVLECASQQAVAEFGEAVVTRGWPLAVISTGALADAALQQRLQQACRQHRGQVIVLSGA
VAGMDGLASAREGGLDSVTYQACKSPASWRGSMAEQLIDLDAVSEAQVFFEGSAREAARL
FPANANVAATIALNGLGMDATRVRLLVDPATRRNTHRLQVCGNFGEFHIELSGNPLASNP
KTSTLAALSAVQACRRLIDGGFIA