Protein Info for IAI46_20960 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details amino acids 403 to 420 (18 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 387 (361 residues), 206 bits, see alignment E=1.2e-64 amino acids 280 to 420 (141 residues), 43.2 bits, see alignment E=3.9e-15

Best Hits

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_4141)

Predicted SEED Role

"Putative 2-ketogluconate transporter, ACS family-MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>IAI46_20960 MFS transporter (Serratia liquefaciens MT49)
MNTASVSVSRSQVIPKLRWLRIVPPILITCIISYMDRVNIAFAMPGGMDDELGITASMAG
LAGGIFFIGYLFLQVPGGKLAVYGNGKKFIGWSLLAWAVISVLTGLVSNQYQLLFLRFAL
GVSEGGMLPVVLTMISNWFPDKERGRANAIVIMFVPIAGILTAPLSGWIITAWDWRMLFL
VEGALSLVVMVLWYFTISNRPQEAKWISQAEKDYLIKTLHDEQLLIKGKTVRNASLRRVL
GDKIMWQLIMVNFFYQTGIYGYTLWLPTILKGLTNGNMEQVGMLAILPYIGAIFGMLIIS
TLSDRTGKRKVFVALPLACFAICMALSVLLKDHIWWSYAALVGCGVFIQAAAGVFWTIPP
KLFNAEVAGGARGVINALGNLGGFCGPYMVGVLISLFSKDVGVYSLAVSLAIASVLALML
PNKCDQKAGAE