Protein Info for IAI46_20910 in Serratia liquefaciens MT49

Annotation: LysR family transcriptional regulator ArgP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR03298: transcriptional regulator, ArgP family" amino acids 5 to 293 (289 residues), 369.7 bits, see alignment E=4.6e-115 PF00126: HTH_1" amino acids 7 to 64 (58 residues), 66.3 bits, see alignment E=1.9e-22 PF03466: LysR_substrate" amino acids 93 to 289 (197 residues), 52.3 bits, see alignment E=5e-18

Best Hits

Swiss-Prot: 99% identical to ARGP_SERP5: HTH-type transcriptional regulator ArgP (argP) from Serratia proteamaculans (strain 568)

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 99% identity to srs:SerAS12_4132)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>IAI46_20910 LysR family transcriptional regulator ArgP (Serratia liquefaciens MT49)
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENLFGQPLLVRTVPPRPT
EQGQKLLALLHQVELLEEEWLGNDTGIDTPLLLSLAVNADSLATWLLPALKPVLTDSPIR
LNLQVEDETRTQERLRRGEVVGAVSIQPQPLPSCLVDRLGALDYLFVASKGFAERYFPNG
VTRSALLKAPAVAFDHLDDMHQAFLQQNFDLSPGSVPCHIVNSSEAFVQLARQGTTCCMI
PHLQIEKELESGELIDLTPGLFQRRMLFWHRFAPESRMMRKVTDALLEHGRQVLRQD