Protein Info for IAI46_20855 in Serratia liquefaciens MT49

Annotation: glycine cleavage system protein GcvH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 3 to 126 (124 residues), 175.1 bits, E=3.1e-56
• PF01597: GCV_H
  • amino acids 8 to 126 (119 residues), 155 bits, E=4.2e-50

Best Hits

Swiss-Prot: 94% identical to GCSH_SERP5: Glycine cleavage system H protein (gcvH) from Serratia proteamaculans (strain 568)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 92% identity to rah:Rahaq_3498)

MetaCyc: 76% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Protein Sequence (128 amino acids)

>IAI46_20855 glycine cleavage system protein GcvH (Serratia liquefaciens MT49)
MSNVPTELKYASSHEWVRSEGNGVYTVGITEHAQELLGDMVFVDLPEVGRVVAAGEDCAV
AESVKAASDIYAPISGEIVAVNAELEGSPELVNSEPYGEGFLFQIKASDESELANLLDAG
AYQASIDE