Protein Info for IAI46_20775 in Serratia liquefaciens MT49

Annotation: hemolysin III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details PF03006: HlyIII" amino acids 21 to 217 (197 residues), 138.7 bits, see alignment E=1.2e-44 TIGR01065: channel protein, hemolysin III family" amino acids 23 to 224 (202 residues), 237.4 bits, see alignment E=5.6e-75

Best Hits

Swiss-Prot: 82% identical to YQFA_ECO57: UPF0073 inner membrane protein YqfA (yqfA) from Escherichia coli O157:H7

KEGG orthology group: K11068, hemolysin III (inferred from 98% identity to spe:Spro_3900)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>IAI46_20775 hemolysin III family protein (Serratia liquefaciens MT49)
MGKTGVVKAGTEKIAAAAYPWAEEIANSISHGIGLVFGIVGLVLLLVQAVDSGADVTAIT
SYSLYGGSMILLFLASTLYHAIPHQKAKHWLKKFDHCAIYLLIAGTYTPFLLVGLNSPLA
KGLMAVIWGLALLGVLFKLAFAHRFEALSLVTYLTMGWLSLIVIYQLATRLALGGVTLLA
VGGVVYTLGVIFYASKRFRFGHAIWHGFVLGGSLCHFMAIYLYV