Protein Info for IAI46_20615 in Serratia liquefaciens MT49

Annotation: L-lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 26 to 43 (18 residues), see Phobius details amino acids 50 to 75 (26 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 120 to 136 (17 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 387 to 404 (18 residues), see Phobius details amino acids 416 to 439 (24 residues), see Phobius details amino acids 448 to 471 (24 residues), see Phobius details amino acids 477 to 496 (20 residues), see Phobius details amino acids 508 to 526 (19 residues), see Phobius details PF02652: Lactate_perm" amino acids 1 to 524 (524 residues), 460.5 bits, see alignment E=4.2e-142 TIGR00795: transporter, lactate permease (LctP) family" amino acids 1 to 526 (526 residues), 428.2 bits, see alignment E=2.6e-132

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 90% identity to spe:Spro_3854)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>IAI46_20615 L-lactate permease (Serratia liquefaciens MT49)
MSLFFSVAPIVLLIWMMTKRNGVPSYLALPLTAAVVYTVQLLWFDSAPLLLHANIVTALV
AVLTPITIIAGAILLNKLMQISGAENVVRRWLENISPNPVAQLMIIGWAFAFMIEGASGF
GTPAAIAAPILVGLGFNPLRVALLTLVMNSVPVSFGAVGTPTWFGFANLGLSDASLLEIG
RQTALIHFVAGFAIPLLALRFIVSWRDIRRNLPFILLSVLSCTLPYLLLAQVNYEFPALV
GGAIGLAVSVLLARAGIGLVRVDKNQERGQPVPFIQVLKAMTPTLLLIAILIVTRIHQLG
IKALLNSTAPLWQGSLGWLGELRVSDALIIELQQVLGTQAAASYKTLYVPALIPFLLVVV
LCIPLFRLNRHQVKQMFSETGQRIAKPFIALLGALVMVNLMMQGENDAPVILIGKALAAL
TGESWLLFSSFLGALGSFFSGSNTVSNLTFGGIQQSIALSSGLNVNLTLALQSVGGAMGN
MVCLNNIIAVCSILGIGNAEGKIIRKTVLPMLAYGGIAAVMAQILAL