Protein Info for IAI46_20555 in Serratia liquefaciens MT49

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 20 to 295 (276 residues), 190.9 bits, see alignment E=5.9e-60 PF05992: SbmA_BacA" amino acids 26 to 345 (320 residues), 133.7 bits, see alignment E=2.1e-42 PF00005: ABC_tran" amino acids 382 to 516 (135 residues), 80.9 bits, see alignment E=3e-26

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 92% identity to spe:Spro_3843)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>IAI46_20555 ABC transporter ATP-binding protein/permease (Serratia liquefaciens MT49)
MNTIPTPKNAVWQLIKPFWVSEEKLRAWAMLIAIIALSLGLVYISVLINQWNQVFYDALQ
NKNYPVFKAQLWRFTYLALIFIVLAVFKIYLTQGLQMHWRRWMTEKFMGKWLAHQAYYHT
EQQQIVDNPDQRIAEDLNVLTQYTLSLSLGLLSSLVTLFSFIAILWHVSGPITFVISQHA
ITLPGYMVWFALLYAGLGSLLIWWVGKPLVQLGFNQERYEANFRFGLIRIRENNDAIALY
HGEPHEAQQLGGRFEAIRANWWSIMRITRRLNIASNFYSQFAIVFPLLVAAPRYFSGAIQ
MGGMMQIASAFGQVQSALSWFIDAFTDLATWKACVNRLAGFNAAVDQVHHQQRGIQLQPE
NEQPMVLDRLSLQLPDGQRLLEPTSMTLKRGDRVLIVGPSGCGKSTLLRAIAGIWPYGSG
AIGLDAASSTLFLPQRSYIPIGTLREALSYPHLAAEYSDEQLLKALDNCRLKHLQRWLDT
SANWSQRLSPGEQQRLAFARAILTRPDILFLDEATSALDDETEQLMYCLLVDELPDVTLV
SVAHRNSVAKYHQSCWRFSRAEESQPARMALSPLPVAG