Protein Info for IAI46_20355 in Serratia liquefaciens MT49

Annotation: cysteine desulfurase sulfur acceptor subunit CsdE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 TIGR03391: cysteine desulfurase, sulfur acceptor subunit CsdE" amino acids 3 to 139 (137 residues), 237.2 bits, see alignment E=2.6e-75 PF02657: SufE" amino acids 17 to 138 (122 residues), 133.8 bits, see alignment E=1.4e-43

Best Hits

Swiss-Prot: 64% identical to CSDE_ECOLI: Sulfur acceptor protein CsdE (csdE) from Escherichia coli (strain K12)

KEGG orthology group: K02426, cysteine desulfuration protein SufE (inferred from 92% identity to spe:Spro_3808)

MetaCyc: 64% identical to sulfur acceptor protein CsdE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE, sulfur acceptor protein CsdE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>IAI46_20355 cysteine desulfurase sulfur acceptor subunit CsdE (Serratia liquefaciens MT49)
MLTPHPFGREITAEALIEKFTALKQWEDRYRQLIMLAKQLPPLPEALRAAEMELSGCENR
VWLGHQLQADGTLHFYGDSEGRIVRGLLAVLLTAVEGKTPQQIAAMDPLGLFDQLALRAQ
LSATRASGLEALAAAVKAIGTRYA