Protein Info for IAI46_20310 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details PF00083: Sugar_tr" amino acids 16 to 197 (182 residues), 68.2 bits, see alignment E=6.9e-23 PF07690: MFS_1" amino acids 23 to 308 (286 residues), 153.7 bits, see alignment E=6.5e-49 amino acids 236 to 401 (166 residues), 60.6 bits, see alignment E=1.3e-20

Best Hits

Swiss-Prot: 64% identical to Y1104_HAEIN: Putative metabolite transport protein HI_1104 (HI_1104) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_3798)

Predicted SEED Role

"Major facilitator superfamily (MFS) transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>IAI46_20310 MFS transporter (Serratia liquefaciens MT49)
MPAITTTKNHATPGKAMLASVTGYAMDGFDLLILGFMLPAISIEMGLSSSAAGSLVTWTL
IGAVLGGVIFGHLSDRFGRIRVLTITILMFSVFTGLCALAQGYWDLLAYRTLAGIGLGGE
FGIGMALIAEAWPAEKRNRASAYVGMGWQLGVLAAAFLTPLLLTHIGWRGMFLVGLLPAL
ASFLIRRTLGEPEAFVRQQSTGEQLSFAQRIRLLFKDRATSKASIGIFILCSVQNFGYYG
LMIWMPTYLAKNFGFSLTKSGLWTAVTVIGMTFGIWLFGVLADRFSRWKIFISYQIGAVV
MVVVYAQLSDPTLMLFAGALMGMFVNGMIGGYGALISDTYPVQARATAQNILFNLGRGVG
GLGPLVIGALVTQVSFAAAISLLAAIYLLDIYATLFLLPKKQVDGDTLGAIG