Protein Info for IAI46_20240 in Serratia liquefaciens MT49

Annotation: 1-deoxy-D-xylulose-5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 1 to 390 (390 residues), 599.2 bits, E=1.7e-184
• PF02670: DXP_reductoisom
  • amino acids 4 to 132 (129 residues), 163.2 bits, E=7.3e-52
• PF08436: DXP_redisom_C
  • amino acids 146 to 239 (94 residues), 123 bits, E=6.9e-40
• PF13288: DXPR_C
  • amino acids 271 to 387 (117 residues), 143.7 bits, E=4.5e-46

Best Hits

Swiss-Prot: 97% identical to DXR_SERP5: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Serratia proteamaculans (strain 568)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 97% identity to spe:Spro_3786)

MetaCyc: 74% identical to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate reductoisomerase. [EC: 1.1.1.267]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• isoprene biosynthesis I (9/10 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Protein Sequence (398 amino acids)

>IAI46_20240 1-deoxy-D-xylulose-5-phosphate reductoisomerase (Serratia liquefaciens MT49)
MKQLTILGSTGSVGTSTLAVVRENPDRFAIKALVAGHNVAVMAQQCMEFRPTYAAMADEG
AARELRTLLAENGVATEVMAGEQAACDLAALDDVDQVTAAIVGAAGLLPTLAAIRAGKQV
LLANKESLVTCGRLFMDAVQKSQTQLLPLDSEHNAIFQSLPESIQRQLGYSSLDSHGVSR
IVLTGSGGPFRTTPLEQFATMTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAEQMEVILHPQSVIHSMVRYTDGSVLAQLGTPDMRTPIAHAMAYPQRVSSGVEALDFC
RIGSLTFAEPERERYPCLYLAIEAFDAGQAATTALNAANEVAVAAFLQEQIRFTDIAAVN
QKVVERLSLQEPSCIDAVLEIDRQAREVAVGLVKSLRN