Protein Info for IAI46_20150 in Serratia liquefaciens MT49

Annotation: cadaverine/lysine antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 263 to 287 (25 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 383 to 401 (19 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 2 to 433 (432 residues), 452.9 bits, see alignment E=6.7e-140 PF13520: AA_permease_2" amino acids 7 to 421 (415 residues), 146 bits, see alignment E=1.7e-46 PF00324: AA_permease" amino acids 19 to 378 (360 residues), 81 bits, see alignment E=8.1e-27

Best Hits

Swiss-Prot: 88% identical to CADB_ECO57: Probable cadaverine/lysine antiporter (cadB) from Escherichia coli O157:H7

KEGG orthology group: K03757, cadaverine:lysine antiporter (inferred from 95% identity to spe:Spro_3768)

MetaCyc: 88% identical to lysine:cadaverine antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-68; TRANS-RXN0-212

Predicted SEED Role

"Lysine/cadaverine antiporter membrane protein CadB" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>IAI46_20150 cadaverine/lysine antiporter (Serratia liquefaciens MT49)
MASSKKIGLIACTGVVAGNMMGSGIALLPANLASLGSIAIWGWVISIIGAMSLAYVYARL
ATKNPQQGGPIAYAGEISPAFGFQTGVLYYHANWIGNLAIGITAVSYLSTFFPALNNPVP
AGIACIAIVWVFTFINLLGGSWVSRLTTMGLVLVLIPVIVTATAGWHWFDAATYQANWNT
SGTTDFHAVIKSILLCLWAFIGVESAAVSTGMVKNPKRTVPLATMLGTALAGIIYVAATQ
VISGMYPASEMAASGAPFAISASTIMGGWAAPMVSAFTAFACLTSLGSWMMLVGQAGVRA
ANDGNFPKVYGEVDKNGVPKKGLLLASCKMTALMVLITAMSSGGGKASDLFGMLTGIAVL
LTMLPYFYSCVDLIRFEGVNIRNLLSLIASVLGCGFCFIALMGADSFELSGTFIISLIIL
MFYARKMNTRQTAKANGVALDGNTTAKAH