Protein Info for IAI46_20140 in Serratia liquefaciens MT49

Annotation: dipeptide permease DtpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 9 to 35 (27 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 238 to 255 (18 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 404 to 427 (24 residues), see Phobius details amino acids 451 to 472 (22 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 6 to 455 (450 residues), 262 bits, see alignment E=6.3e-82 PF07690: MFS_1" amino acids 21 to 421 (401 residues), 64.2 bits, see alignment E=1.1e-21 PF00854: PTR2" amino acids 77 to 437 (361 residues), 261.3 bits, see alignment E=1.5e-81

Best Hits

Swiss-Prot: 67% identical to DTPC_ECOLI: Dipeptide and tripeptide permease C (dtpC) from Escherichia coli (strain K12)

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 95% identity to spe:Spro_3766)

MetaCyc: 67% identical to dipeptide/tripeptide:H+ symporter DtpC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-267; TRANS-RXN0-288

Predicted SEED Role

"Di/tripeptide permease YjdL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>IAI46_20140 dipeptide permease DtpD (Serratia liquefaciens MT49)
MKTPSQPRAIYYVVAIQIWEYFSFYGMRALLILYLTHQLGYSDSRAISLYSAYASLVYVT
PILGGLLADRLLGNRVAVIAGAVLMTLGHIVLGLSAVSTHSLYLALAIIICGYGLFKSNI
SCLLGELYQPQDSRREGGFSLLYAAGNVGSILAPIACGLAAERYGWHVGFALAGIGMLAG
LAIFLFGSRHFTHTRGVDRAQMCANTLKVPNWVWLSAMLLLAPLFFTSLFIYGLAGQLLM
LVCAAAVVMVARIMIRATREQRRGLWQIVMLMLLGTLFWAFAQQGGSSISLFIDHYVDRQ
WFSWTVPTALFQSVNAFAVMFGGVMLAWLVRGNGSGSRTLRIWGKFAFGLLLIGVGFTLM
ALNARYGQGSMFLMIAGLSVMGLAELFIDPVAMAQITRLNIPGATGVLTGIYMLTTGSIA
NYLAGIIAGQTAEDPATGATAQAYAHLFSQIGWWALGCTAAVIAVLAMWWLLTGRHLRAV
NA