Protein Info for IAI46_20135 in Serratia liquefaciens MT49

Annotation: tRNA lysidine(34) synthetase TilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 19 to 201 (183 residues), 172.2 bits, see alignment E=1.2e-54 PF01171: ATP_bind_3" amino acids 20 to 196 (177 residues), 198.2 bits, see alignment E=1.5e-62 PF09179: TilS" amino acids 246 to 313 (68 residues), 77.4 bits, see alignment E=1.2e-25 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 361 to 406 (46 residues), 57.6 bits, see alignment 6.6e-20 PF11734: TilS_C" amino acids 361 to 433 (73 residues), 92.8 bits, see alignment E=1e-30

Best Hits

Swiss-Prot: 88% identical to TILS_SERP5: tRNA(Ile)-lysidine synthase (tilS) from Serratia proteamaculans (strain 568)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 88% identity to spe:Spro_3765)

MetaCyc: 56% identical to tRNAIle-lysidine synthetase (Escherichia coli K-12 substr. MG1655)
RXN-1961 [EC: 6.3.4.19]

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>IAI46_20135 tRNA lysidine(34) synthetase TilS (Serratia liquefaciens MT49)
MNSNQLSGQLARQLGARRHLLVAFSGGLDSSVLLHLLVQLRQQLPELQLRAVHVHHGLSF
FADRWVEHCRQQCAAWQLPLVVQYVQVDGRQDGIEAAARAARYSAFAATLAVDETLLTAQ
HLDDQCETFLLALKRGSGPAGLSAMAAQTSLGNNGLLRPLLGSSRQQLEAYAQQHQLSWI
EDDSNQDSRFDRNFLRLQVLPLLNQRWPHFAAATARSATLCAEQEQLLDELLAEQLHSLL
DEENALAIDGLLGCSPARRFALLRRWIAARGASMPSREQLQRLWDEVALSREDAEPQLQL
GQYQIRRFRRRLYLLPLMAELRQTCLPWSLSEPLMLPDGLGELVSGEGDIVLRAPQPLQK
VSVRFSAQGKLRILGRTHSRPIKKLWQELGIPPWQRERTPLIYYDDQLIAALGVFVSEAG
QPAEGQQPLRLQWRKK