Protein Info for IAI46_20040 in Serratia liquefaciens MT49

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 35 to 52 (18 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details amino acids 334 to 357 (24 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 402 to 420 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 22 to 218 (197 residues), 97.8 bits, see alignment E=1.8e-31 amino acids 221 to 415 (195 residues), 47 bits, see alignment E=4.7e-16 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 27 to 412 (386 residues), 462.1 bits, see alignment E=8.8e-143 PF07690: MFS_1" amino acids 41 to 380 (340 residues), 102.8 bits, see alignment E=4.9e-33 amino acids 272 to 420 (149 residues), 45.4 bits, see alignment E=1.4e-15 PF13347: MFS_2" amino acids 162 to 361 (200 residues), 29.8 bits, see alignment E=6e-11 PF12832: MFS_1_like" amino acids 258 to 358 (101 residues), 26.5 bits, see alignment E=8.5e-10

Best Hits

Swiss-Prot: 79% identical to KGTP_SHIFL: Alpha-ketoglutarate permease (kgtP) from Shigella flexneri

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 98% identity to spe:Spro_3751)

MetaCyc: 79% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"Alpha-ketoglutarate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>IAI46_20040 MFS transporter (Serratia liquefaciens MT49)
MEDGNTVDPAVQDKKKRIFAIVGASSGNLVEWFDFYVYSFCSIYFAASFFPAGNSTTQLL
QTAGVFAAGFFMRPIGGWLFGYIADKHGRKNSMLISVCMMCAGSLVIACLPTYESIGSWA
PVLLLVARLFQGLSVGGEYGTSATYMSEVAIKGRRGFYASFQYVTLIGGQLLALLVLVAL
QQILSAEELKAWGWRIPFAIGAVLAVVALYLRRSLNETSDAKTRNHKDAGSLKGLWKNRK
AFLMVLGFTAGGSLSFYTFTTYMQKYLVNTSGMDAKLASGIMTAALFIYMLLQPLVGALS
DKIGRRSSMLIFASLATLLTVPILLTLKNVSNPYAAFGLIVLALFIVSFYTSISGLLKAE
MFPPEVRALGVGLSYAVANAMFGGSAEYVALSLKSFGFENAFFWYVSGMCLLALIVSLRL
HRKGKEIQL