Protein Info for IAI46_19985 in Serratia liquefaciens MT49

Annotation: L-valine transporter subunit YgaH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05437: AzlD
  • amino acids 5 to 104 (100 residues), 46.2 bits, E=2.1e-16

Best Hits

Swiss-Prot: 56% identical to YGAH_ECOLI: Uncharacterized protein YgaH (ygaH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to spe:Spro_3740)

MetaCyc: 56% identical to L-valine exporter, YgaH component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-269

Predicted SEED Role

"Branched-chain amino acid transport, AzlD"

Protein Sequence (117 amino acids)

>IAI46_19985 L-valine transporter subunit YgaH (Serratia liquefaciens MT49)
MNTDVLVIGLVVGCANYLFRYLPLRLAPARAQPGIKRGKTALLLDSIGIASICALLVVSS
TPVVMREPDKLWPTLAGFAALGLCFYRTKSIILSTLIGAASFGITLKLFMIFSQGNL