Protein Info for IAI46_19955 in Serratia liquefaciens MT49

Annotation: glycine betaine/L-proline ABC transporter permease ProW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 112 to 134 (23 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 208 to 235 (28 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 179 to 347 (169 residues), 101.1 bits, see alignment E=3.2e-33

Best Hits

Swiss-Prot: 77% identical to OUSW_DICD3: Glycine betaine/choline transport system permease protein OusW (ousW) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 96% identity to spe:Spro_3734)

MetaCyc: 85% identical to glycine betaine ABC transporter membrane subunit ProW (Escherichia coli K-12 substr. MG1655)
RXN-8638 [EC: 7.6.2.9]; 7.4.2.- [EC: 7.6.2.9]

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>IAI46_19955 glycine betaine/L-proline ABC transporter permease ProW (Serratia liquefaciens MT49)
MSDTTQDPWATAPADPSAAPATDAATSTAPAGDAWSSTPPPETHDAANQAAQGADWLNSA
PVQQEHFSLLDPFHKTWVPFDSWVTHGIDWLVLHFRPLFQGIRVPVDFILSGFQQLLLGM
PAPIAILLFSLIAWQLSSLGMGAATLVSLIAIGAIGAWSQAMVTLALVLTALFFCIVIGL
PLGIWLARSKHAGKVIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVR
LTILGINQVPEDLIEAAESFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASM
IAVGGLGQMVLRGIGRLDMGLAAVGGVGIVILAIILDRLTQSLGRDRRSKGIGRWYAHGP
IGLVTRPFIKKP