Protein Info for IAI46_19895 in Serratia liquefaciens MT49

Annotation: glutaredoxin-like protein NrdH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 78 PF00462: Glutaredoxin" amino acids 3 to 61 (59 residues), 53.7 bits, see alignment E=1e-18 TIGR02194: glutaredoxin-like protein NrdH" amino acids 3 to 73 (71 residues), 111.3 bits, see alignment E=9.7e-37

Best Hits

Swiss-Prot: 44% identical to NRDH_ECOLI: Glutaredoxin-like protein NrdH (nrdH) from Escherichia coli (strain K12)

KEGG orthology group: K06191, glutaredoxin-like protein NrdH (inferred from 94% identity to srs:SerAS12_3915)

MetaCyc: 49% identical to mycoredoxin 2 (Corynebacterium glutamicum ATCC 13032)

Predicted SEED Role

"Glutaredoxin-like protein NrdH, required for reduction of Ribonucleotide reductase class Ib" in subsystem Glutaredoxins or Glutathione: Redox cycle or Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (78 amino acids)

>IAI46_19895 glutaredoxin-like protein NrdH (Serratia liquefaciens MT49)
MSIIIYSKPDCVQCNATYRAFDKQGIGYQVIDLTQDQQALNHVKSLGYQQVPVIIAGEDH
WSGFRPDKIGALAHALAS