Protein Info for IAI46_19665 in Serratia liquefaciens MT49

Annotation: tyrosine-type recombinase/integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF13356: Arm-DNA-bind_3" amino acids 8 to 94 (87 residues), 79.2 bits, see alignment E=2.1e-26 PF00589: Phage_integrase" amino acids 214 to 377 (164 residues), 103.5 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 58% identical to INTA_ECOLI: Prophage integrase IntA (intA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to eca:ECA0835)

Predicted SEED Role

"Phage integrase, Phage P4-associated"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>IAI46_19665 tyrosine-type recombinase/integrase (Serratia liquefaciens MT49)
MARTTRPLTHTEVQKAKAIEKDLTLHDGDGLFLLVKTTGKKLWRFRYLRPGTSSRTMVSL
GAYPALSLADARQIRAEKLAILARGIDPQAKEAEEAEQKHVAQESIFLNVAKQWFTLKQA
SVSTKHAEDIWRSLEKDILPSIENVPVQDIKARLLIQVLEPIKARGALETVRRLVQRINE
IMIYAVNTGLIDANPASGIGNAFERPKKQHMPTIRPEELPKLMRTISMSNLSIPTRCLLE
WQLLTLIRPAEASATAWAEIDIENREWHIPAERMKAKRDHIVPLSNQALEILEIMHPISG
RREHVFPSRNDPRKPMNSQTANAALKRIGYAGKLVAHGLRSIASTALNEAEFNPDVIEAS
LAHYDRNEVRRAYNRATYIEQRKDLMAWWGSFIQRSHSV