Protein Info for IAI46_19605 in Serratia liquefaciens MT49

Annotation: ankyrin repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details PF12796: Ank_2" amino acids 80 to 173 (94 residues), 45.4 bits, see alignment E=2.4e-15 amino acids 140 to 205 (66 residues), 34.2 bits, see alignment E=7.8e-12 PF13606: Ank_3" amino acids 108 to 136 (29 residues), 19.4 bits, see alignment (E = 2.7e-07) PF00023: Ank" amino acids 108 to 139 (32 residues), 19.5 bits, see alignment 2.5e-07 amino acids 143 to 173 (31 residues), 20.6 bits, see alignment 1.1e-07 amino acids 176 to 206 (31 residues), 22 bits, see alignment 3.9e-08 PF13637: Ank_4" amino acids 145 to 187 (43 residues), 28.7 bits, see alignment 3.3e-10

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 82% identity to spe:Spro_3680)

Predicted SEED Role

"Putative phospholipase A accessory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>IAI46_19605 ankyrin repeat domain-containing protein (Serratia liquefaciens MT49)
MPERRRLWQTLMVATLAVIAIAGLLMMAKEQQMNQEISPFNGRSNLALAQAVARGDSNGI
AEQATEARLHEQGDRQVTLLQWAILSQQTQSLSSLLALGADATTPGLDGNSALHTAAAVQ
DPQYLRLLLAHGVPLNPRNAVTGATPLAAAVLAGREEQVRLLLVSGADVTLSDRLGDTPL
HLAAKINAPLLALMLLQAGADAKARNQQGVAFQFYLSQTPTALQNEEMRDRYRQLNAWLK
AHQQVAQYGQQ