Protein Info for IAI46_19570 in Serratia liquefaciens MT49

Annotation: SoxR-reducing system protein RseC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 transmembrane" amino acids 79 to 100 (22 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details PF04246: RseC_MucC" amino acids 8 to 139 (132 residues), 117.7 bits, see alignment E=1.7e-38

Best Hits

Swiss-Prot: 53% identical to RSEC_ECOLI: Protein RseC (rseC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to srr:SerAS9_3864)

Predicted SEED Role

"Sigma factor RpoE regulatory protein RseC" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>IAI46_19570 SoxR-reducing system protein RseC (Serratia liquefaciens MT49)
MMKEWATVVSWQQGVALLRCEPKAGCGSCTARSGCGARALNELVPETEHQLQVRIEQPLE
PGQRVEVGIAEGSLLRSAMLVYLTPLVGMMLGGSLLQYWLGTDASAALGALLGGGLAFIL
ARGLAHRLGEQANYQPVVLQIGLPPGAMRLQTENEPLR