Protein Info for IAI46_19555 in Serratia liquefaciens MT49

Annotation: signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 64 to 82 (19 residues), see Phobius details PF10502: Peptidase_S26" amino acids 60 to 303 (244 residues), 181.5 bits, see alignment E=6.6e-58 TIGR02227: signal peptidase I" amino acids 66 to 160 (95 residues), 87.1 bits, see alignment E=5.8e-29 amino acids 259 to 305 (47 residues), 62.5 bits, see alignment 2.2e-21

Best Hits

Swiss-Prot: 73% identical to LEP_ECOLI: Signal peptidase I (lepB) from Escherichia coli (strain K12)

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 99% identity to spe:Spro_3670)

MetaCyc: 73% identical to signal peptidase I (Escherichia coli K-12 substr. MG1655)
Signal peptidase I. [EC: 3.4.21.89]

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>IAI46_19555 signal peptidase I (Serratia liquefaciens MT49)
MANMFALILALATLVTGIIWAFERFRWAPARRAKIAAVNAQTAGAVDDKTLAKVAKQPGW
IETGASVFPVLLLVFVVRSFIYEPFQIPSGSMMPTLLIGDFILVEKYAYGIKDPITQTTL
IETGHPKRGDIAVFKYPLDPKLDYIKRVVGLPGDRVSYDPVNKRVTVQPSCNSGQSCDTA
LAVTYNDAQPSDFVQLFSRSGMGEASNGFYQIPLSDNVPQGGIRLRERQETLGSVSHHIL
TVPGTQDQVGAYYQQPGKQLAEWVVPAGHYFMMGDNRDNSADSRYWGFVPEKNLVGKATA
IWMSFEKQEGEWPTGVRFSRIGGIH