Protein Info for IAI46_19455 in Serratia liquefaciens MT49

Annotation: NAD+ synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00795: CN_hydrolase
  • amino acids 7 to 239 (233 residues), 96.5 bits, E=1.7e-31
• PF02540: NAD_synthase
  • amino acids 264 to 512 (249 residues), 237.9 bits, E=9.7e-75
• TIGR00552: NAD+ synthetase
  • amino acids 265 to 511 (247 residues), 195.3 bits, E=5.3e-62

Best Hits

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_3842)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5) / Glutamine amidotransferase chain of NAD synthetase" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

• aspartate superpathway (25/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (6/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (6/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
• NAD de novo biosynthesis II (from tryptophan) (6/9 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Protein Sequence (540 amino acids)

>IAI46_19455 NAD+ synthase (Serratia liquefaciens MT49)
MSRSLSIALAQLNLLVGDIEGNTERMLQTVQQQQKAGADLVMFTELALSGYPPEDLLYRN
DFYQRCDEQLLRLQQTSTDVAILVGHPWREGDKLYNALSLFSEGQLLARYFKQQLPNYGV
FDEKRYFQAGNDTCVVELKGYRLGLLICEDLWFPEPVDAAKAAGAEMILSINASPYNREK
PYIRKTLMAGHCQRTHLPLVYLNQIGGQDELIFDGCSKVFDAAGNMTHRLAAFAEQVTLL
EFNELDVVPMTAPAAELPQLAQVYEALVLAVRDYVTKNGFKGAVLGLSGGIDSALTLAIA
VDALGKDKVQALMMPFRYTADISIADAREEAEILGIEFDIVSIEPMFDAFMGQLTPMFAG
TERDTTEENLQARCRGVVLMALSNKRRSIVLTTGNKSEMAVGYATLYGDMAGGFDVLKDV
PKTLVFKLSEYRNTVSYVIPQRVIDRPPSAELAPDQLDQDSLPPYDILDAILEGYVERDK
SVADLVAEGFDEAIVRKVIRLVDINEYKRRQAAVGPRITARNFGKDRRYPITSGFGRKNW