Protein Info for IAI46_19375 in Serratia liquefaciens MT49

Annotation: nickel/cobalt transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 74 to 102 (29 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 255 to 281 (27 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details PF03824: NicO" amino acids 75 to 326 (252 residues), 130.4 bits, see alignment E=4.4e-42

Best Hits

KEGG orthology group: None (inferred from 94% identity to srs:SerAS12_3836)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>IAI46_19375 nickel/cobalt transporter (Serratia liquefaciens MT49)
MSVNLSQPATRKRHWVFSLWPLLLFALLLALGARLAWHYWPQLLLQSVVWQKGLHLQMAG
LLQQVKAAPEQAGLALMLFSLSYGVLHALGPGHGKVVIATYLATHPARLKSSLKLTFAAS
LVQGLVAIALVTLMLVVLQLSSRQLHQSSFWLEKGSFVLVMLLGVLLTWRALKRLYHAVK
TLRPQPALRINSLQPLPADHVHSEHCGCGHRHLPSDTELQAGSDWRTQTAIVLAMGMRPC
SGAILVLLFSKVIGVFAWGVISALAMALGTSLTISLLALLVHYSRRLAVRLSRSRAPAAW
SAVAWGSLALAGGLILLFAGLLLYASAQPEFGGGIRPFSR