Protein Info for IAI46_19350 in Serratia liquefaciens MT49

Annotation: Fe-S cluster assembly scaffold IscU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01592: NifU_N
  • amino acids 2 to 126 (125 residues), 181.6 bits, E=3.2e-58
• TIGR01999: FeS cluster assembly scaffold IscU
  • amino acids 3 to 125 (123 residues), 230.8 bits, E=1.6e-73

Best Hits

Swiss-Prot: 92% identical to ISCU_ECOL6: Iron-sulfur cluster assembly scaffold protein IscU (iscU) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to srr:SerAS9_3830)

MetaCyc: 92% identical to scaffold protein for iron-sulfur cluster assembly (Escherichia coli K-12 substr. MG1655)
RXN-14381

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein IscU" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

• [2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)

Protein Sequence (128 amino acids)

>IAI46_19350 Fe-S cluster assembly scaffold IscU (Serratia liquefaciens MT49)
MAYSEKVIDHYENPRNVGSFDNEDPSVGSGMVGAPACGDVMKLQIKVNNEGIIEDARFKT
YGCGSAIASSSLVTEWMKGKSLDQAEAIKNTQIAEELELPPVKIHCSILAEDAIKAAIAD
YKSKHNAK