Protein Info for IAI46_19270 in Serratia liquefaciens MT49

Annotation: histidine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 TIGR00442: histidine--tRNA ligase" amino acids 6 to 411 (406 residues), 526 bits, see alignment E=3.3e-162 PF13393: tRNA-synt_His" amino acids 10 to 312 (303 residues), 156.3 bits, see alignment E=1.7e-49 PF00587: tRNA-synt_2b" amino acids 68 to 320 (253 residues), 109 bits, see alignment E=4.4e-35 PF03129: HGTP_anticodon" amino acids 330 to 416 (87 residues), 40.1 bits, see alignment E=4.9e-14

Best Hits

Swiss-Prot: 98% identical to SYH_SERP5: Histidine--tRNA ligase (hisS) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 98% identity to spe:Spro_3608)

MetaCyc: 84% identical to histidine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Histidine--tRNA ligase. [EC: 6.1.1.21]

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>IAI46_19270 histidine--tRNA ligase (Serratia liquefaciens MT49)
MAKNIQAIRGMNDYLPEETALWQRIEGILKQVLSGYGYSEIRLPIVEQTPLFKRAIGEVT
DVVEKEMYTFDDRNGESLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYVGPMFRYERPQKG
RYRQFHQLGAEVFGLQGPDIDAELILLSARWWKALGIADHVKLELNSIGSLEARANYRDA
LVAFLEQHQDKLDEDCKRRMYSNPLRVLDSKNPEVQALLNDAPRLSEYLDEESKAHFEGL
CELLAQAGIPYTINERLVRGLDYYNRTVFEWVTTSLGAQGTVCAGGRYDGLVEQLGGRAT
PAVGFAMGLERLVLLVQAVNPEFKAPATIDVYVISSGAGTQSAAMQLAERVRDAAPQLKL
MTNYGGGNFKKQITRADKWGARVALILGENEVAAEQVVVKDLRSGEQETLAQSEVAVRLA
LMLG