Protein Info for IAI46_19250 in Serratia liquefaciens MT49

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 241 to 269 (29 residues), see Phobius details amino acids 289 to 312 (24 residues), see Phobius details PF03547: Mem_trans" amino acids 14 to 307 (294 residues), 67.3 bits, see alignment E=9.4e-23 PF01758: SBF" amino acids 213 to 312 (100 residues), 30.8 bits, see alignment E=2.4e-11

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 95% identity to srs:SerAS12_3809)

Predicted SEED Role

"Possible AEC family malate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>IAI46_19250 AEC family transporter (Serratia liquefaciens MT49)
MSWETWSFAFSVTVPNLLMMLLGVLLRHWRMMDDRFIDGATRLVFNLALPCLLFFSIATN
HPQLLGNLSLVIYGAVGTVATFLLLEIAAVWLVKEPRERGVFVQGGFRANTAIVGLAYAM
TAYGSEGVALGSLYLTVTVILFNVLSVVTLTRSLQGGEGKKISRLSLLRSIVTNPLIIGL
VCGLLFAQTGLEIPQVIRQTGSYISGLSLPLALLCTGASLDLRAMFRSSNVAALSSSAKL
FLVPILMTLGGWLCGFQGAALGIIFLFSATPTASGSYVMTRAMGGNATLAANIIAITTVG
SFFTTALGIYFLRSWGVI