Protein Info for IAI46_19080 in Serratia liquefaciens MT49

Annotation: DNA-binding transcriptional repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF08279: HTH_11" amino acids 6 to 50 (45 residues), 24.9 bits, see alignment 2.3e-09 PF08220: HTH_DeoR" amino acids 6 to 58 (53 residues), 59.5 bits, see alignment E=3.3e-20 PF00455: DeoRC" amino acids 74 to 232 (159 residues), 176.2 bits, see alignment E=7.7e-56

Best Hits

Swiss-Prot: 71% identical to SRLR_ECOLI: Glucitol operon repressor (srlR) from Escherichia coli (strain K12)

KEGG orthology group: K02468, DeoR family transcriptional regulator, glucitol operon repressor (inferred from 98% identity to spe:Spro_3574)

Predicted SEED Role

"Glucitol operon repressor" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>IAI46_19080 DNA-binding transcriptional repressor (Serratia liquefaciens MT49)
MKPKQRQAAILEYLQRHGKTAVDALAAHFATTGTTIRKDLTLLEEEGEVIRTYGGVVLSR
DDGDQPIDRKTHINTEKKRQIAYAAIGLINDGDSLIFDAGSTVLQMVPHLAQFNNITVMT
NSLHIVNALVELDNDQTILMPGGTYRKKSASFHGSLAESAFQQFSFDKLFIGADGVDLNA
GVTTFNEVHNVSKAMCEAASRIILLVDSSKFGRKSPNVVCDLSAVDTLITDKNINPDYLA
ALQAKGINIILVGDFDE