Protein Info for IAI46_19020 in Serratia liquefaciens MT49

Annotation: lipid kinase YegS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00781: DAGK_cat" amino acids 6 to 129 (124 residues), 101.9 bits, see alignment E=2e-33 TIGR03702: lipid kinase YegS" amino acids 7 to 298 (292 residues), 460.6 bits, see alignment E=1.8e-142 TIGR00147: lipid kinase, YegS/Rv2252/BmrU family" amino acids 8 to 293 (286 residues), 300.3 bits, see alignment E=1.2e-93 PF19279: YegS_C" amino acids 151 to 288 (138 residues), 37.6 bits, see alignment E=1.9e-13

Best Hits

Swiss-Prot: 93% identical to YEGS_SERP5: Probable lipid kinase YegS-like (Spro_3562) from Serratia proteamaculans (strain 568)

KEGG orthology group: K07029, (no description) (inferred from 93% identity to spe:Spro_3562)

MetaCyc: 66% identical to lipid kinase YegS (Escherichia coli K-12 substr. MG1655)
2.7.1.-

Predicted SEED Role

"Transcription regulator [contains diacylglycerol kinase catalytic domain]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>IAI46_19020 lipid kinase YegS (Serratia liquefaciens MT49)
MHSPAPALLIINGKGAGNDEVRLAVQKLRDEGQPLHVRVTWEQGDAARYAREACQLGVKT
LIAGGGDGTINEVAAALTTLPAAGRPVLGILPLGTANDFAMACNIPLMPEQALRLAVKGR
AVPIDLAKVNDERYFINMATGGFGTRITTETPEKLKAALGGVSYFIHGLLRMDTLKADRC
EIRGPDFHWAGNALVIGIGNGKQAGGGQQLCPDALINDGLLQLRLLIADELLPALVASLF
NDEENKNVISAALPWLEIKAPHEMTFNLDGEPLKGKHFRIEVLPHAIECRLPPNCGLLGQ
GPTPE