Protein Info for IAI46_18970 in Serratia liquefaciens MT49

Annotation: MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 66 to 393 (328 residues), 265.1 bits, see alignment E=3.8e-83 PF16576: HlyD_D23" amino acids 90 to 312 (223 residues), 46.7 bits, see alignment E=3.6e-16 PF13533: Biotin_lipoyl_2" amino acids 91 to 139 (49 residues), 57.2 bits, see alignment 1.7e-19 PF13437: HlyD_3" amino acids 202 to 303 (102 residues), 27.6 bits, see alignment E=6.1e-10

Best Hits

Swiss-Prot: 72% identical to MDTA_YERE8: Multidrug resistance protein MdtA (mdtA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 91% identity to spe:Spro_3552)

MetaCyc: 74% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>IAI46_18970 MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit (Serratia liquefaciens MT49)
MNAKNPRRSLLLRLLVVVIVAIVAVLIWRHFSAPQPADNAAPGARHAGGVKAAAGAGRRG
APMSPVQAATATQQTVPRYLSGLGTATAANTVTVTSRVDGQLMAIHFTEGQQVKAGDLLV
EIDPRPFQVQLAQAQGQLAKDQATLANARRDLARYQQLAKTNLVSRQDLDTQLSLVQQTE
GAIKADQGSVDSAKLQITYSRITAPIDGRVGLKLVDVGNYITSGSTTGIVVITQTHPIDV
VFTLPEATISDLIKAQKAGPVSVEAWDRTNQNLLSTGSLLSLDNQIDTATGTIKLKARFT
NEDDALFPNQFVNARLKVATLLDAIVIPTAALQMGNEGNFVWTLSEDNKVSKHLVTTGVQ
DSQKVVINAGLNAGDRVVTDGIDRLTEGMQVEVVTPQAASAAGKPIHSPRTQGKS