Protein Info for IAI46_18925 in Serratia liquefaciens MT49

Annotation: sensor domain-containing phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details PF05231: MASE1" amino acids 39 to 330 (292 residues), 46.1 bits, see alignment E=3.7e-16 PF00563: EAL" amino acids 509 to 739 (231 residues), 218.5 bits, see alignment E=9.1e-69

Best Hits

KEGG orthology group: None (inferred from 87% identity to spe:Spro_3543)

Predicted SEED Role

"Putative cytochrome C-type biogenesis protein" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (750 amino acids)

>IAI46_18925 sensor domain-containing phosphodiesterase (Serratia liquefaciens MT49)
MELRPDGLVIFMIKPIFWKHLRERWWGCPLLWSLLLIPFAGWLSPRIMLPEGKVYLLYLP
LTACIALLMVYDWRALPGIALAIMLRYAHRLGLESGLLVTLLYLSCLSLCWLGYRRQTQR
RWCAAPGGAALVKERLIWLVVLPALLFVFGLKLLVAFARLPDELGMMPGDNSYLMALVNF
QALLLGCLSAMPLLYIMLRILNKPRFALTLWRRFGREMAPNVDKKELSLWLLVLVGMVAV
LSHHAKEAIPLLLGGYGLVLLLPVMLYGAMRFGYQFNCLIWSATLLVLFFHYPGASQPDN
LLHNLAVISSMMVVFTLCIFLMSALNTHQRLSHARAQSASLQDPVIGLPNLRALKRDLAQ
SPPSTLCFLRVSELDLLSRNYGMQLRIRFKQQLAALLHQVLAPGEGVYHLPGYDLLLRVD
ADNSEEKVEAIYRALEKFRLIWNGLPLHPPLGLGYCSVLPDFEHLYQLLGELSALAEVSL
TSGKPENVQSSGNLVQDEVKRKVALLHGVQRSLDNDGFILMAQPIVGLRGDRYYEILLRM
LDDQGNTVSPNDFLPVAHEFGLAYRLDLWVLRNTLKFMDQHRIDLPSARFAVNLTPSSLC
RPMLSQDVDNLLQQYRIEPYQLTLEVTESHLLQNTDYAGANLQALREMGCRIALDDFGTG
YAGYDRLKMLPVDMLKIDGSFVRDMLTSAVDFQVIASICKVARMKRLTIVAEYVESLEQL
VALKGVGVDYMQGYFVGEPQPLVTLLSEQN