Protein Info for IAI46_18910 in Serratia liquefaciens MT49

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 transmembrane" amino acids 21 to 49 (29 residues), see Phobius details amino acids 427 to 449 (23 residues), see Phobius details amino acids 461 to 481 (21 residues), see Phobius details amino acids 487 to 510 (24 residues), see Phobius details amino acids 522 to 545 (24 residues), see Phobius details amino acids 567 to 590 (24 residues), see Phobius details amino acids 612 to 634 (23 residues), see Phobius details amino acids 681 to 702 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 500 to 710 (211 residues), 37.4 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 93% identity to spe:Spro_3540)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (720 amino acids)

>IAI46_18910 ABC transporter permease subunit (Serratia liquefaciens MT49)
MAQTTVNQHPRDRLRARIDRSVQAAVTVSGLLVLMTLMLIFVYLLFAVLPLFKPAAMGQA
KPLTISASAPALALGMDVQQRIGYRIDAQGQGQFYPLTQQNVHPLTQQTLLAQPTLLTQA
AGERDLFALAQADGRFIVASADFAAAGASAPQWLFPLGQRPLTLDKQGRALTLLTLAEAR
RGQYLLAGVTEDRRLVFGRFGSDHPPQLSEITLDSAVQQLVLTPDGRQLYLLAGNRLARY
QINDTQLQLKETRTLGEHSPYQLTALPGGSALLIEAPDGSVREWFDVEKDRRWQLTPVQH
FDHQSEPQDLLVAEPYRRVFATLRPDGGFSLFSSIQPQPLLNGRLSAGVQQMAFAPRGDG
LLLETAQGWQHYAIDNPYPDVTWRSLWHKVWYENYPEPAYVWQSTSGEDSYQAKFSLMPV
IFGTFKAAAYAMLFAIPLALAGAVYTAYFMSAGLRRVIKPAIEVMGALPTVVIGLVAGIW
LAPVIEYYLLAVLSLPLLLAAMVLACGALMNRFAPRRLPPGVDLLILLPLIVLTVWLAFS
VGPWLEVKLFGEPLHFWLGDDYDQRNALVVGVAMGFALVPIIFSLAEDALFSVPATLSQG
SLALGATQWQTVIRVVLPSASAGIFSALMIGFGRAVGETMIVLMATGNTPVIDGSLFQGL
RALAANIAIEMPEAVAGSSHYRVLFLTALVLFIFTFVFNTLAEAIRLRLRERYTLNQEAP