Protein Info for IAI46_18905 in Serratia liquefaciens MT49

Annotation: phosphate ABC transporter permease PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 299 to 327 (29 residues), see Phobius details amino acids 339 to 367 (29 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details amino acids 435 to 458 (24 residues), see Phobius details amino acids 515 to 536 (22 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 282 to 541 (260 residues), 243.8 bits, see alignment E=9.2e-77 PF00528: BPD_transp_1" amino acids 318 to 470 (153 residues), 52.3 bits, see alignment E=2.9e-18

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 97% identity to spe:Spro_3539)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>IAI46_18905 phosphate ABC transporter permease PstA (Serratia liquefaciens MT49)
MKRWAKSGSPWIWLTAGSVAVSLLALIGIMLLLAGQGMRYFWPSPVYQFELNQSAAGPVT
MIGELYQQQSIPRRQLLESGIALPPGNAQSFERYLIKVGNRESEGQDFRTLLAGDIVRQS
TPRDLLVLERNNNGTAYGYLAGMLEDGQPLTGRNLSQALLQRLPQIAALSRQAHDIQFRD
MARINQRFDTLRLREKSLQREDKLDARAQASINAERLELQRQYRLLSDRLEGLNRDRHRD
ALLLRDMHGQTHTIALSQVRDAWYPNAMNTTQKLVHWGEQVKKFLSDSPREANTEGGVFP
AIFGTVLMVILMSIVVMPFGVIAAVYLHEYAGNNLLTRLIRIAVVNLAGVPSIVYGVFGL
GFFVYMIGGTLDQLFYPESLPNPTFGTPGVLWAALTLALLTLPVVIVATEEGLSRIPASL
RQGSLALGASRAETLWRIVLPMAAPAMMTGLILAVARAAGETAPLMLVGVVKSVPVLPVD
DIFPYLHLERKFMHLSFQIYDMAFQSPSVEAARPLVFATAFLLVAIVVGLNLAAMGIRHS
LRERYRAWSQ