Protein Info for IAI46_18880 in Serratia liquefaciens MT49
Annotation: uracil phosphoribosyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to UPP_PECCP: Uracil phosphoribosyltransferase (upp) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)
KEGG orthology group: None (inferred from 99% identity to srr:SerAS9_3730)MetaCyc: 93% identical to uracil phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Uracil phosphoribosyltransferase. [EC: 2.4.2.9]
Predicted SEED Role
"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)
MetaCyc Pathways
- superpathway of pyrimidine ribonucleosides salvage (10/10 steps found)
- superpathway of pyrimidine nucleobases salvage (4/4 steps found)
- pyrimidine nucleobases salvage II (2/2 steps found)
- pyrimidine nucleobases salvage I (1/1 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.4.2.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (208 amino acids)
>IAI46_18880 uracil phosphoribosyltransferase (Serratia liquefaciens MT49) MKIVEVKHPLVKHKLGLMRENDISTKRFRELASEVGSLLTYEATADLETEKVTIDGWCGP VEIDQIKGKKITVVPILRAGLGMMEGVLENVPSARISVVGVYRDEETLEPVPYFQKLVSN IEERLALVVDPMLATGGSMIATIDLLKKAGCNSIKVLVLVAAPEGIAALEKAHPDVELYT ASIDQCLNEKGYIVPGLGDAGDKIFGTK