Protein Info for IAI46_18870 in Serratia liquefaciens MT49

Annotation: GlsB/YeaQ/YmgE family stress response membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 82 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 28 to 52 (25 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details PF04226: Transgly_assoc" amino acids 33 to 81 (49 residues), 57.4 bits, see alignment E=6.8e-20

Best Hits

Swiss-Prot: 87% identical to YEAQ_ECOLI: UPF0410 protein YeaQ (yeaQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to eca:ECA2044)

Predicted SEED Role

"Transglycosylase associated protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (82 amino acids)

>IAI46_18870 GlsB/YeaQ/YmgE family stress response membrane protein (Serratia liquefaciens MT49)
MGIISWIIFGLIAGILAKWIMPGKDGGGFILTVVLGIVGAVVGGYISTFFGYGRVDGFNF
GSFVVAVIGAIVVLFVYRKIRS