Protein Info for IAI46_18815 in Serratia liquefaciens MT49

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 37 to 63 (27 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details PF01810: LysE" amino acids 16 to 201 (186 residues), 84.5 bits, see alignment E=3.4e-28

Best Hits

KEGG orthology group: None (inferred from 82% identity to srs:SerAS12_3717)

Predicted SEED Role

"transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>IAI46_18815 LysE family translocator (Serratia liquefaciens MT49)
MTLAIFAAFWAVSILFVITPGLDWAYIISAGIRGRVVVPAVVGLLCGHLIAIAIVAAGVG
ALVTGNPMALTALTLLGAGYLLWIGINMLRHPPTPSAGDAQASGSWLRWAGKGICVSGLN
PKVFLLFLALLPQFTDAGASWSIPNQILALGLLHLISCGVVYLIVGYGSQSVLQTRPQAA
RVVSRFSGAAMVLIAVGLLVEQGIK