Protein Info for IAI46_18800 in Serratia liquefaciens MT49

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07715: Plug" amino acids 83 to 180 (98 residues), 56 bits, see alignment E=5.3e-19 TIGR01783: TonB-dependent siderophore receptor" amino acids 85 to 732 (648 residues), 401.2 bits, see alignment E=4.7e-124 PF00593: TonB_dep_Rec" amino acids 253 to 700 (448 residues), 117.4 bits, see alignment E=1.5e-37

Best Hits

Swiss-Prot: 53% identical to FCUA_YEREN: Ferrichrome receptor FcuA (fcuA) from Yersinia enterocolitica

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 79% identity to kpn:KPN_00536)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (732 amino acids)

>IAI46_18800 TonB-dependent siderophore receptor (Serratia liquefaciens MT49)
MHNTSSTSFPQRLTLLALAIGAVSQGALAAPTESSKKNQEETLVVQATKESDFKAGGEDL
VPAYLDGQIAHGGRLGMLGEQKAMDVPFNVVGYTAKLVQDQQAKTIADVISNDAGVQAVQ
GYGNFAETYRIRGFQLDGEDMTMGGLSGVVPRQVMDTQMLERVEVFKGANALLNGVATSG
VGGMINLEPKRAEETPTTQVGIDYTSDSQVGGKLDVGRRFGDDNQFGARVNLVHREGEAA
VNDDKRRTTLASVGLDYRGDRLRTSLDFGYQKKTFHGGTMGVNISGVDFIPAVPDPTKNY
SQKWGYSDIENEFGMVKAEYDLTQRWKIYTGLGAQHAHETGLYSAPKLINANGDATVGRL
DTNRIIDAFSGMAGVSGEFNTWDVSHKVNLGYSAQIKRDKTAWRMSANNPTTNIYDNHDV
AVPDNAYFGGNYSDPLTTARNRTQGWLFSDTLGFFSDRVLFTAAARHQKVVVRNYSNATG
LEDTSSRYTQSRWMPTFGLVYKPSEEVSLYANHTEALQPGSNAPKEATNFGQSTGIARSK
QNEVGVKVDFERVGGSLALFEIKKPSAMLNSENYYALDGEQRNRGVELNVFGEPMLGLRL
NGSTTWLSPELTKTKNGTNDGKDAIGVSNFYMVMGAEYDIQPVEGLTATARVRHTGSQFA
DAANTKKLDSYTTLDLGVRYRMRMNADQNTLVWRVGVDNVTNEKYWSSVESNGTYIFQGQ
SRTLKASLTYDF