Protein Info for IAI46_18680 in Serratia liquefaciens MT49

Annotation: two-component system response regulator NarL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00072: Response_reg" amino acids 8 to 120 (113 residues), 102.1 bits, see alignment E=3.1e-33 PF04545: Sigma70_r4" amino acids 148 to 192 (45 residues), 25.8 bits, see alignment 9e-10 PF00196: GerE" amino acids 150 to 203 (54 residues), 81.4 bits, see alignment E=4.2e-27

Best Hits

Swiss-Prot: 66% identical to NARP_HAEIN: Nitrate/nitrite response regulator protein homolog (narP) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07685, two-component system, NarL family, nitrate/nitrite response regulator NarP (inferred from 95% identity to spe:Spro_3490)

MetaCyc: 45% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Nitrate/nitrite response regulator protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>IAI46_18680 two-component system response regulator NarL (Serratia liquefaciens MT49)
MVMKNYRVMIVDDHPLMRRGIKQLLGLDPLFNVVAEASNGNEAITFALQQAPDVILLDLN
MKGLSGLDTLKALRNEGVDARIIVLTVSDSRNDVYALIDAGADGYLLKDSEPEQLLEHIR
SAAEGQNVISDAVADYLLSRSEQHNPFAELTERELDVLQEVARGLSNKQVAAQLHISEET
VKVHIRNMLRKLDVRSRVAATVMYLEHRSQ