Protein Info for IAI46_18655 in Serratia liquefaciens MT49

Annotation: nitrate reductase cytochrome c-type subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03892: NapB
  • amino acids 48 to 143 (96 residues), 157.3 bits, E=1.1e-50

Best Hits

Swiss-Prot: 69% identical to NAPB_SHIFL: Periplasmic nitrate reductase, electron transfer subunit (napB) from Shigella flexneri

KEGG orthology group: K02568, cytochrome c-type protein NapB (inferred from 95% identity to spe:Spro_3485)

MetaCyc: 69% identical to periplasmic nitrate reductase cytochrome c550 protein (Escherichia coli K-12 substr. MG1655)
Nitrate reductase (cytochrome). [EC: 1.9.6.1]

Predicted SEED Role

"Nitrate reductase cytochrome c550-type subunit" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

• sn-glycerol 3-phosphate anaerobic respiration (2/3 steps found)
• nitrate reduction IV (dissimilatory) (1/2 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.9.6.1

Protein Sequence (149 amino acids)

>IAI46_18655 nitrate reductase cytochrome c-type subunit (Serratia liquefaciens MT49)
MKSPVMKKTLALWVTLLSLAFAGLAFAAGDVDLSKSPEVSASVGGPISMPKQQERMALNY
VNQPPMIPHSVDGYQISKNTNRCLQCHGVEHYRTTGAPRISPTHFMDRDGKVLSDVAPRR
YFCLQCHVPQTDAAPIVGNDFQPMPGFGR