Protein Info for IAI46_18645 in Serratia liquefaciens MT49

Annotation: GDP-mannose pyrophosphatase NudK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family
  • amino acids 9 to 186 (178 residues), 198.6 bits, E=3.7e-63
• PF00293: NUDIX
  • amino acids 45 to 176 (132 residues), 46.4 bits, E=2e-16

Best Hits

Swiss-Prot: 96% identical to NUDK_SERP5: GDP-mannose pyrophosphatase NudK (nudK) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_3483)

MetaCyc: 63% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"Nudix hydrolase family protein YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Protein Sequence (191 amino acids)

>IAI46_18645 GDP-mannose pyrophosphatase NudK (Serratia liquefaciens MT49)
MSAKIENVKKELLSDNWYVLHKYTFDLKRKDGGSVQQMREVYDRGNGATILLYNRAKGTV
VLTNQFRMPTYVNGNDSGMLLEACAGLLDADSPEQCARREAVEETGFQVGDVQKIFEAYM
SPGGVTEIVHFFIAEYHDDERNAAGGGIEDEDIEVVELPFTEAVAMIADGRIKDGKTIML
LQYLQIHRIMG