Protein Info for IAI46_18620 in Serratia liquefaciens MT49

Annotation: lytic polysaccharide monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF03067: LPMO_10" amino acids 28 to 193 (166 residues), 167.6 bits, see alignment E=2.5e-53

Best Hits

KEGG orthology group: K03933, chitin-binding protein (inferred from 98% identity to spe:Spro_3478)

MetaCyc: 93% identical to lytic chitin monooxygenase CBP21 (Serratia marcescens)
RXN-18080 [EC: 1.14.99.53]

Predicted SEED Role

"Chitin binding protein" in subsystem Chitin and N-acetylglucosamine utilization

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.99.53

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>IAI46_18620 lytic polysaccharide monooxygenase (Serratia liquefaciens MT49)
MNNTSRTLMSLGLLSAALFGVSQQAAAHGYVETPASRSYQCKLQLNTQCGSVQYEPQSVE
GLKGFPQAGPADGHIASADKSTFFELDQQTPTRWNKINLHTGANSFTWRLTARHSTTSWR
YFITKPNWDASQPLTRASFDLTPFCQQNDGGAIPAAQVTHQCNIPADRSGSHVILAVWDV
ADTTNAFYQAIDVNLTK