Protein Info for IAI46_18575 in Serratia liquefaciens MT49

Annotation: S-methylmethionine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 96 to 122 (27 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details amino acids 435 to 453 (19 residues), see Phobius details PF00324: AA_permease" amino acids 19 to 456 (438 residues), 418.4 bits, see alignment E=3.7e-129 PF13520: AA_permease_2" amino acids 20 to 433 (414 residues), 146.1 bits, see alignment E=1.6e-46

Best Hits

Swiss-Prot: 80% identical to MMUP_ECOLI: Probable S-methylmethionine permease (mmuP) from Escherichia coli (strain K12)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 97% identity to spe:Spro_3470)

MetaCyc: 80% identical to CP4-6 prophage; S-methyl-L-methionine transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-486

Predicted SEED Role

"S-methylmethionine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>IAI46_18575 S-methylmethionine permease (Serratia liquefaciens MT49)
MHSPVPAAGQFKRTMKARHLVMLSLGGVIGTGLFFNTGYIISTTGALGTLLAYLIGALVV
YLVMLCLGELSVAMPETGAFHVYASRYLGPATGYTVAWLYWLTWTVALGSSLTAAGFCMQ
YWFPQSPVWLWCLIFCAAIFLLNVVTTRFFAESEFWFSLIKVITILAFIILGGAAMFGLL
PMKDGTPAPFLHNLTASGWLPNGTLPILMTMVAVNFAFSGTELIGIAAGETENPEKVVPW
AIRTTVIRLMLFFVGTVFILAALIPMDQAGIVKSPFVLVFERIGVPYAADIFNFVILTAI
LSAANSGLYASGRMLWSLANQRTLPAYFSRVNKRGIPINALTFSMLGGVLALLTSVIAPD
TVFVALSAISGFAVVAVWLSICASHYAFRRHYLRSGQPIAGLKYRAPGYPLTPIVGFSLC
LLACIGLAFDPEQRIALYCGLPFVALCYAAYYLTRRSGQKTSLGENHVG