Protein Info for IAI46_18535 in Serratia liquefaciens MT49

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 17 to 123 (107 residues), 80.5 bits, E=3.7e-26
• PF13673: Acetyltransf_10
  • amino acids 34 to 124 (91 residues), 45.5 bits, E=2.3e-15
• PF13508: Acetyltransf_7
  • amino acids 43 to 124 (82 residues), 60.5 bits, E=5e-20
• PF13480: Acetyltransf_6
  • amino acids 45 to 107 (63 residues), 32.3 bits, E=3.2e-11
• PF08445: FR47
  • amino acids 67 to 125 (59 residues), 38.9 bits, E=2.1e-13

Best Hits

Swiss-Prot: 90% identical to Y1711_SODGM: Acetyltransferase SG1711 (SG1711) from Sodalis glossinidius (strain morsitans)

KEGG orthology group: None (inferred from 99% identity to srs:SerAS12_3657)

Predicted SEED Role

"Acetyltransferase YpeA"

Protein Sequence (141 amino acids)

>IAI46_18535 GNAT family acetyltransferase (Serratia liquefaciens MT49)
MEIRVFRQDDFEEVITLWERCDLLRPWNDPEMDIERKLNHDPDLFLVAEVGGEVVGSVMG
GYDGHRGSAYYLGVHPDYRGRGIANALISRLEKKLIARGCPKIQLMVREDNDTVIEMYEK
LGYEIQSITSLGKRLIEDQEY