Protein Info for IAI46_18505 in Serratia liquefaciens MT49

Annotation: sulfate/thiosulfate ABC transporter permease CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 195 to 223 (29 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 7 to 268 (262 residues), 370.5 bits, see alignment E=5.2e-115 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 8 to 270 (263 residues), 374.3 bits, see alignment E=3.7e-116 PF00528: BPD_transp_1" amino acids 75 to 273 (199 residues), 94.5 bits, see alignment E=3.3e-31

Best Hits

Swiss-Prot: 87% identical to CYST_ECOLI: Sulfate transport system permease protein CysT (cysU) from Escherichia coli (strain K12)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 98% identity to srs:SerAS12_3651)

MetaCyc: 87% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>IAI46_18505 sulfate/thiosulfate ABC transporter permease CysT (Serratia liquefaciens MT49)
MLLSSKRVLPGFGLSLGSSLFYTCLILLLPLSALVMQLAQMSLAQYWEVVSNPQVVAAYK
VTLLAAGVASLFNAVFGMLMAWILTRYRFPGRTLLDGLIDLPFALPTAVAGLTLAGLFST
TGWYGQWLAHFDIKVTFTWLGIAVAMAFTSLPFVVRTVQPVLEELGPEYEEAAETLGATR
WQSFRRVVMPELAPALLAGTAISFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFVRLQEFD
YPAASAIASVILAASLLLLFSINVLQSRFGRRIGGH