Protein Info for IAI46_18470 in Serratia liquefaciens MT49

Annotation: HAMP domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details PF00672: HAMP" amino acids 160 to 214 (55 residues), 47.4 bits, see alignment 2.9e-16 PF00512: HisKA" amino acids 219 to 281 (63 residues), 48 bits, see alignment E=1.6e-16 PF02518: HATPase_c" amino acids 329 to 436 (108 residues), 83.1 bits, see alignment E=2.9e-27

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 91% identity to spe:Spro_3451)

Predicted SEED Role

"Putative two-component system sensor kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>IAI46_18470 HAMP domain-containing protein (Serratia liquefaciens MT49)
MRGRLFWKILLGFWLTFIIMTQALWVAFSLYGDRYEPPENAMTRRAVTLQLTSAATQLRE
GGLPALNAMLKDWSDDDRGLLSVTPMAQPPAAEEPVFEGRRRLKEVTAWVKDSGGTGYLL
SYDMRALREEYSPNRRPHVFNIPMPMLWVGGLAGLLFSTVLAWNLTRPMRKLRDGFDRVA
QGDLSVRLFPAMRRRHDELSEVARDFDSMAERLELLVSAREQLLHDVSHELRSPLARLQL
AIGLARQNAGNVENSLQRIEHEAGRLDKMIGELLALSRAESNSLPDEEYFDLYGLVDAVV
SDARYEAQIPGVEIVLQASSDVEYTVKGNAELMRRAVDNIVRNALRFSSHGQRVTVVLTR
IDQLFQIEVSDQGPGVEESKLSSIFDPFVRVKSSMSGKGYGLGLAITRKVVLAHGGQVEA
RNGEQEGLVITLRIPRWQ