Protein Info for IAI46_18420 in Serratia liquefaciens MT49

Annotation: bile acid:sodium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 125 to 150 (26 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details PF13593: SBF_like" amino acids 6 to 314 (309 residues), 370.4 bits, see alignment E=8e-115 PF01758: SBF" amino acids 40 to 213 (174 residues), 57.4 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 77% identical to YFEH_ECOLI: Putative symporter YfeH (yfeH) from Escherichia coli (strain K12)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 97% identity to spe:Spro_3442)

Predicted SEED Role

"Putative cytochrome oxidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>IAI46_18420 bile acid:sodium symporter (Serratia liquefaciens MT49)
MRFLPDRFTLTLIATVLLASFLPARGEFVGWLNALTIAAIALLFFMHGAKLSREAILAGS
NNWRLHLWVMFSTFIIFPALGVLFKWWSPVNVSPELYSGFIYLCILPATVQSAIAFTSLA
GGNVAAAVCSASASSLLGIFVSPLLVGLLMNVHGETGSLQQVGSIVLQLLVPFVAGHLSR
PLIGKWIERNRKLIGKTDQTSILLVVYAAFSEAVTHGIWHQVGLGSLVFIIVGSLVLLTI
VLVMNTYMARWLGFSKADEITIVFCGSKKSLANGIPMANILFPAATVGIMVLPLMVFHQV
QLMTCAVLARRYQKKQQEKQAVPNAETARG