Protein Info for IAI46_18375 in Serratia liquefaciens MT49

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00496: SBP_bac_5" amino acids 68 to 448 (381 residues), 348.6 bits, see alignment E=2.3e-108

Best Hits

Swiss-Prot: 69% identical to DPPA_ECOLI: Periplasmic dipeptide transport protein (dppA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_3431)

MetaCyc: 69% identical to dipeptide ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) or Bacterial Chemotaxis (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>IAI46_18375 ABC transporter substrate-binding protein (Serratia liquefaciens MT49)
MKTKTLTMTLGLLALAAMGGARASTLVYCSESSPEGFNPQLFTSGPTVDASSATIYNRLV
DFKTGTVELQPSLAESWQVSEDGKNYTFHLRKGVKFQSNKYFTPTRDFNADDVIFSFMRQ
KDANNPYHKVSNGAYTNFESMEFGTLINNIVKVDDNTVRFELSRAEAPFVADLGMYFATI
LSAEYADAMLKAGTPQRVDNDPIGTGPFQLVQYQKDAKILYKAFDHYWEGKPKVDRLVFS
ITPDAAVRYAKLQKNECQVMPFPNPADLTRMRQDPNIQVMEKSGLNIGFLAFNTQKKPLD
NVKVRQALALAVNKPAILEAVFHGAGQPAKNLLPPTQWGSNDKIEDYPYSPEKAKKLLQE
AGLGQGFAIDLWAMPVQRPYNPNAKRMAEMIQSDWAKIGVKAKIVTFEWGEYLQRIKNGE
HQTALMGWTTANGDPDNFFGPLFTCVSANGGSNSAKWCYPPFDKLISQAREENDHAKRVA
MYEQAQVMMHDQMPALMIAHSTIFEPVRKEVKGYEIDPFGKHIFKQVSLEK