Protein Info for IAI46_18340 in Serratia liquefaciens MT49

Annotation: Fe(3+)-siderophore ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 260 to 287 (28 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details PF01032: FecCD" amino acids 41 to 348 (308 residues), 287.9 bits, see alignment E=4.3e-90

Best Hits

Swiss-Prot: 64% identical to FEPD_ECOLI: Ferric enterobactin transport system permease protein FepD (fepD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to srr:SerAS9_3617)

MetaCyc: 64% identical to ferric enterobactin ABC transporter membrane subunit FebD (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Ferric enterobactin transport system permease protein FepD (TC 3.A.1.14.2)" in subsystem Siderophore Enterobactin (TC 3.A.1.14.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>IAI46_18340 Fe(3+)-siderophore ABC transporter permease (Serratia liquefaciens MT49)
MLRITRNCTPSIPLSRDHLAGGTPRSFRRKLLGLLIAFCALLVVMLLSLSLGAKSIPFDT
VIQALNGQCSGADCTIITNARLPRTLIGVLAGIALGLSGVLMQTLTRNPLADPGILGVNA
GAGFAVVLGITFFGAAHVGEYLWFAFAGAMFAALLVALIGALGGSSLNPVRLTLAGVALA
AVLEGMTSGISLLNPLVFDQLRFWQAGSLDIQNMQVVRTVALPILLGTAITLWMSKSLNS
LSMGNELATALGTGIVRTQLLGLLAITLLCGGATAAVGPIAFVGLMMPHIARRLAGSELH
WMLPWTLVLTPILLLSADLIGRFLVAGELRVSIVTALIGAPLLIMLVRQRHMFRRQR