Protein Info for IAI46_18330 in Serratia liquefaciens MT49

Annotation: Fe2+-enterobactin ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01497: Peripla_BP_2
  • amino acids 47 to 296 (250 residues), 99.1 bits, E=1.3e-32

Best Hits

Swiss-Prot: 61% identical to FEPB_ECOL6: Ferrienterobactin-binding periplasmic protein (fepB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 87% identity to spe:Spro_3422)

MetaCyc: 61% identical to ferric enterobactin ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Ferric enterobactin-binding periplasmic protein FepB (TC 3.A.1.14.2)" in subsystem Siderophore Enterobactin (TC 3.A.1.14.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Protein Sequence (319 amino acids)

>IAI46_18330 Fe2+-enterobactin ABC transporter substrate-binding protein (Serratia liquefaciens MT49)
MKKNLFFGFALFGMLAMGAAHATEAGWPRKIETSHGVVTLQQPPTRIVSTSVTVTGTLLA
IDAPVIASGATTPGSRLADSQGFFHQWSAIATQRGVKRLYIGEPNAEAIAGEAPDLIIIS
ATGADSAVRLYDQLSAIAPVLVVNYDDKSWQALAIELGQATGHEAKAQKIVDDFDSREKS
LKQRMTLPEQPTSALVFSADGKSANLWTAESSQGQMLKQLGFTLAVPSDKLNNSRSMGMR
KDIIQLAGENLAEGLNGQTLMLFANNESDAQRLMANPFLAHLPAVQHKRVYALGNDTFRL
DYYSASNLLTLLEKQFISQ