Protein Info for IAI46_18255 in Serratia liquefaciens MT49

Annotation: Nramp family divalent metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 237 to 262 (26 residues), see Phobius details amino acids 283 to 309 (27 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 388 to 406 (19 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 20 to 377 (358 residues), 326.6 bits, see alignment E=1.4e-101 PF01566: Nramp" amino acids 38 to 384 (347 residues), 415.3 bits, see alignment E=1.1e-128

Best Hits

Swiss-Prot: 88% identical to MNTH_YERE8: Divalent metal cation transporter MntH (mntH) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: None (inferred from 93% identity to srr:SerAS9_3608)

MetaCyc: 80% identical to Mn2+/Fe2+: H+ symporter MntH (Escherichia coli K-12 substr. MG1655)
RXN0-2421; TRANS-RXN-241

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>IAI46_18255 Nramp family divalent metal transporter (Serratia liquefaciens MT49)
MLNSDVVETTSRPARKIKLSLMGPAFIAAIGYIDPGNFATNIQAGASFGYTLLWVVVWAN
VMAMLIQLLSAKLGIATGKNLAEHIRDRFPRPAVWAYWVQAEIIAMATDLAEFIGAAIGF
KLLLGVTLLQGAILTGIATFLILMLQKRGQKPLEMVIGGLLLFVAAAYMVELVFSQPQLE
PLLKGMAIPDLPNGDAVFLAAGVLGATIMPHVIYLHSSLTQTGGEHSKADRYAATKFDVA
IAMTIAGFVNLAMMATAAAAFHFNGHSGIADLDQAYLTLQPLLGQAAATIFGLSLVAAGL
SSTVVGTLAGQVVMQGFVHFYIPLWVRRVVTMLPSFIVIMMGMDATRILVLSQVLLSFGI
ALALVPLLSFTGNRELMGEMVNSRSIQAIGKVIVLVVVGLNGYLLVSSLL